NPY1R, Mouse, Clone: 3A1, Abnova™

Catalog No.	Quantity
89-123-250	100 μg

Catalog No. 89-123-250 Supplier Abnova Corporation Supplier No. H00004886M21

Description

Mouse monoclonal antibody raised against a full-length recombinant NPY1R.

Neuropeptide Y (NPY; MIM 162640) is one of the most abundant neuropeptides in the mammalian nervous system and exhibits a diverse range of important physiologic activities, including effects on psychomotor activity, food intake, regulation of central endocrine secretion, and potent vasoactive effects on the cardiovascular system. Two major subtypes of NPY (Y1 and Y2) have been defined by pharmacologic criteria. NPY receptors, such as NPY1R, have been identified in a variety of tissues, including brain, spleen, small intestine, kidney, testis, placenta, and aortic smooth muscle (Herzog et al., 1992 [PubMed 1321422]).[supplied by OMIM

Sequence: MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVPITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVYDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI

Specifications

• Antigen: NPY1R
• Applications: ELISA
• Classification: Monoclonal
• Clone: 3A1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant NPY1R.
• Formulation: PBS with no preservative; pH 7.4
• Gene: NPY1R
• Gene Accession No.: BC036657
• Gene Alias: NPYR
• Gene Symbols: NPY1R
• Host Species: Mouse
• Immunogen: NPY1R (AAH36657, 1 a.a. ∼ 384 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Unpurified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4886
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ