Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NR0B1, Mouse, Clone: 1F10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant NR0B1.

Manufacturer:  Abnova Corporation H00000190M03A

Catalog No. 89-016-075


  Check Availability
Add to cart

Specifications

Description

This gene encodes a protein that contains a DNA-binding domain. The encoded protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in this gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism. [provided by RefSeq

Sequence: IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI
Description & Specifications

Specifications

NR0B1
1F10
Human
Ascites
NR0B1
AHC, AHCH, AHX, DAX-1, DAX1, DSS, GTD, HHG, NROB1
Murine
IgG3, κ
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA,Western Blot
Unlabeled
nuclear receptor subfamily 0, group B, member 1
In ascites fluid
NM_000475
NR0B1
NR0B1 (NP_000466, 361 a.a. ∽471 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa.
200μL
Human
Primary
190
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit