nuclear receptor subfamily 0, group B, member 1, Mouse, Clone: 1F10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant NR0B1.

Supplier:  Abnova Corporation H00000190M03

Catalog No. 89-000-508

Description

This gene encodes a protein that contains a DNA-binding domain. The encoded protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in this gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism. [provided by RefSeq

Sequence: IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI

Specifications

• Antigen: nuclear receptor subfamily 0, group B, member 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_000475
• Gene Symbols: NR0B1
• Immunogen: NR0B1 (NP_000466, 361 a.a. ∼ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 50 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 1F10
• Description: Mouse monoclonal antibody raised against a partial recombinant NR0B1.
• Gene: NR0B1
• Gene Alias: AHC/AHCH/AHX/DAX-1/DAX1/DSS/GTD/HHG/NROB1
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 190
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG3 κ