nuclear receptor subfamily 0, group B, member 1, Mouse, Clone: 1F10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant NR0B1.

Manufacturer: Abnova Corporation H00000190M03

Catalog No. 89-000-508

  Check Availability
Add to Cart

    Specifications

    Antigen nuclear receptor subfamily 0, group B, member 1
    Applications Enzyme Linked Immunosorbent Assay,Western Blotting
    Clone 1F10
    Conjugate Unlabeled
    Cross Reactivity Human
    Description nuclear receptor subfamily 0, group B, member 1
    Format Affinity Purified
    Formulation In 1X PBS, pH 7.4
    Gene NR0B1
    Gene Accession No. NM_000475
    Gene Alias AHC, AHCH, AHX, DAX-1, DAX1, DSS, GTD, HHG, NROB1
    Gene Symbols NR0B1
    Host Species Mouse
    Immunogen NR0B1 (NP_000466, 361 a.a. ∽471 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
    Isotype IgG3
    Purification Method Protein A column
    Quantity 50μg
    Regulatory Status RUO
    Research Discipline Transcription Regulation
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Whole Molecule Y
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 190

    This gene encodes a protein that contains a DNA-binding domain. The encoded protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in this gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism. [provided by RefSeq

    Sequence: IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit