Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NR0B1, Mouse, Clone: 3G8, Abnova™

Catalog No. 89016076 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-076 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-076 Supplier Abnova Corporation Supplier No. H00000190M07
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant NR0B1.

This gene encodes a protein that contains a DNA-binding domain. The encoded protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in this gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism. [provided by RefSeq

Sequence: IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI

Specifications

Antigen NR0B1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3G8
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant NR0B1.
Formulation PBS with no preservative; pH 7.4
Gene NR0B1
Gene Accession No. NM_000475
Gene Alias AHC/AHCH/AHX/DAX-1/DAX1/DSS/GTD/HHG/NROB1
Gene Symbols NR0B1
Host Species Mouse
Immunogen NR0B1 (NP_000466, 361 a.a. ∼ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 190
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.