nuclear receptor subfamily 1, group H, member 4, Mouse, Clone: 1B10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant NR1H4.

Supplier:  Abnova Corporation H00009971M02

Catalog No. 89-001-159

Description

Sequence: TPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ

Specifications

• Antigen: nuclear receptor subfamily 1, group H, member 4
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_005123
• Gene Symbols: NR1H4
• Immunogen: NR1H4 (NP_005114, 363 a.a. ∼ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 1B10
• Description: Mouse monoclonal antibody raised against a partial recombinant NR1H4.
• Gene: NR1H4
• Gene Alias: BAR/FXR/HRR-1/HRR1/MGC163445/RIP14
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 9971
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ