NR2E1, Mouse, Clone: 2D10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant NR2E1.

Manufacturer: Abnova Corporation H00007101M02A

Catalog No. 89-123-120

  Check Availability
Add to Cart

    Specifications

    Antigen NR2E1
    Applications Enzyme Linked Immunosorbent Assay
    Clone 2D10
    Conjugate Unlabeled
    Cross Reactivity Human
    Description nuclear receptor subfamily 2, group E, member 1
    Format Ascites
    Formulation In ascites fluid
    Gene NR2E1
    Gene Accession No. NM_003269
    Gene Alias TLL, TLX, XTLL
    Gene Symbols NR2E1
    Host Species Mouse
    Immunogen NR2E1 (NP_003260, 249 a.a. ∽ 342 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa.
    Isotype IgG2a, κ
    Quantity 200μL
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 7101

    Sequence: NGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGK

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit