Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NR2E1, Mouse, Clone: 2D10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant NR2E1.

Manufacturer:  Abnova Corporation H00007101M02A

Catalog No. 89-123-120


  Check Availability
Add to cart

Specifications

Description

Sequence: NGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGK
Description & Specifications

Specifications

NR2E1
2D10
nuclear receptor subfamily 2, group E, member 1
NR2E1
Ascites
NR2E1
NR2E1 (NP_003260, 249 a.a. ∽ 342 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa.
200μL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA
Unlabeled
In ascites fluid
NM_003269
TLL, TLX, XTLL
Murine
IgG2a, κ
RUO
Primary
7101
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit