Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001027

nuclear receptor subfamily 2, group E, member 1, Mouse, Clone: 4D2, Abnova™

Catalog No. 89001027 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-027 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-027 Supplier Abnova Corporation Supplier No. H00007101M06
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant NR2E1.

Sequence: NGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGK

Specifications

Antigen nuclear receptor subfamily 2, group E, member 1
Applications ELISA, Immunofluorescence
Classification Monoclonal
Clone 4D2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant NR2E1.
Formulation PBS with no preservative; pH 7.4
Gene NR2E1
Gene Accession No. NM_003269
Gene Alias TLL/TLX/XTLL
Gene Symbols NR2E1
Host Species Mouse
Immunogen NR2E1 (NP_003260, 249 a.a. ∼ 342 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Neurobiology
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 7101
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.