Learn More
NR4A2, Mouse, Clone: 1D9, Abnova™
Mouse monoclonal antibody raised against a full-length recombinant NR4A2.
Supplier: Abnova Corporation H00004929M19
Description
This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq
Sequence: GSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPS*Specifications
NR4A2 | |
Monoclonal | |
Unconjugated | |
PBS with no preservative; pH 7.4 | |
NM_006186 | |
NR4A2 | |
NR4A2 (NP_006177, 147 a.a. ∼ 250 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | |
100 μg | |
Primary | |
Human | |
Antibody | |
IgG2b κ |
ELISA, Western Blot | |
1D9 | |
Mouse monoclonal antibody raised against a full length recombinant NR4A2. | |
NR4A2 | |
HZF-3/NOT/NURR1/RNR1/TINUR | |
Mouse | |
Affinity chromatography | |
RUO | |
4929 | |
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | |
Liquid |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.