Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NR4A2, Mouse, Clone: 3F2, Abnova™

Catalog No. 89123257 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-123-257 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-123-257 Supplier Abnova Corporation Supplier No. H00004929M17
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant NR4A2.

This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq

Sequence: GSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPS*

Specifications

Antigen NR4A2
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3F2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant NR4A2.
Formulation PBS with no preservative; pH 7.4
Gene NR4A2
Gene Accession No. NM_006186
Gene Alias HZF-3/NOT/NURR1/RNR1/TINUR
Gene Symbols NR4A2
Host Species Mouse
Immunogen NR4A2 (NP_006177, 147 a.a. ∼ 250 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4929
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.