nuclear receptor subfamily 4, group A, member 2, Mouse, Clone: 4A6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant NR4A2.

Supplier:  Abnova Corporation H00004929M07

Catalog No. 89-000-851

Description

This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq

Sequence: GFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFP

Specifications

• Antigen: nuclear receptor subfamily 4, group A, member 2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC066890
• Gene Symbols: NR4A2
• Immunogen: NR4A2 (AAH66890, 71 a.a. ∼ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 4A6
• Description: Mouse monoclonal antibody raised against a partial recombinant NR4A2.
• Gene: NR4A2
• Gene Alias: HZF-3/NOT/NURR1/RNR1/TINUR
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 4929
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ