Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001264

nuclear receptor binding protein 1, Mouse, Clone: 2B4, Abnova™

Catalog No. 89001264 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-264 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-264 Supplier Abnova Corporation Supplier No. H00029959M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant NRBP1.

Sequence: PAEVETRKVVLMQCNIESVEEGVKHHLTLLLKLEDKLNRHLSCDLMPNENIPELAAELVQLGFISEADQSRLTSLLEETLNKFNFARNSTLNSAAVTVSS

Specifications

Antigen nuclear receptor binding protein 1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2B4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant NRBP1.
Formulation PBS with no preservative; pH 7.4
Gene NRBP1
Gene Accession No. BC001221
Gene Alias BCON3/FLJ27109/FLJ35541/MADM/MUDPNP/NRBP
Gene Symbols NRBP1
Host Species Mouse
Immunogen NRBP1 (AAH01221, 436 a.a. ∼ 535 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Kinases
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 29959
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.