neuregulin 2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-015-818	50 μL

Catalog No. 89-015-818 Supplier Abnova Corporation Supplier No. H00009542A01

Description

Mouse polyclonal antibody raised against a partial recombinant NRG2.

Neuregulin 2 (NRG2) is a novel member of the neuregulin family of growth and differentiation factors. Through interaction with the Erbb family of receptors, NRG2 induces the growth and differentiation of epithelial, neuronal, glial, and other types of cells. The gene consists of 12 exons and the genomic structure is similar to that of neuregulin 1 (NRG1), another member of the neuregulin family of ligands. NRG1 and NRG2 mediate distinct biological processes by acting at different sites in tissues and eliciting different biological responses in cells. The gene is located close to the region for demyelinating Charcot-Marie-Tooth disease locus, but is not responsible for this disease. Alternative transcripts encoding distinct isoforms have been described. [provided by RefSeq

Sequence: SLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLD

Specifications

• Antigen: neuregulin 2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant NRG2.
• Formulation: 50% glycerol
• Gene: NRG2
• Gene Accession No.: NM_004883
• Gene Alias: Don-1/HRG2/NTAK
• Gene Symbols: NRG2
• Host Species: Mouse
• Immunogen: NRG2 (NP_004874, 116 a.a. ∼ 215 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Apoptosis
• Primary or Secondary: Primary
• Gene ID (Entrez): 9542
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum