Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89014306

NAD(P) dependent steroid dehydrogenase-like, Mouse, Clone: 6E3, Abnova™

Catalog No. 89014306 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-306 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-306 Supplier Abnova Corporation Supplier No. H00050814M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant NSDHL.

The protein encoded by this gene is localized in the endoplasmic reticulum and is involved in cholesterol biosynthesis. Mutations in this gene are associated with CHILD syndrome, which is a X-linked dominant disorder of lipid metabolism with disturbed cholesterol biosynthesis, and typically lethal in males. Alternatively spliced transcript variants with differing 5' UTR have been found for this gene. [provided by RefSeq]

Sequence: MEPAVSEPMRDQVARTHLTEDTPKVNADIEKVNQNQAKRCTVIGGSGFLGQHMVEQLLARGYAVNVFDIQQGFDNPQVRFFLGDLCSRQDLYPALKGVNTVFHCASPPPS

Specifications

Antigen NAD(P) dependent steroid dehydrogenase-like
Applications ELISA, Western Blot
Classification Monoclonal
Clone 6E3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant NSDHL.
Formulation PBS with no preservative; pH 7.4
Gene NSDHL
Gene Accession No. NM_015922
Gene Alias H105E3/SDR31E1/XAP104
Gene Symbols NSDHL
Host Species Mouse
Immunogen NSDHL (NP_057006, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 50814
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.