Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

nuclear distribution gene C homolog (A. nidulans), Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No. 89018243 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-018-243 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-018-243 Supplier Abnova Corporation Supplier No. H00010726D01P
Add to Cart
Add to Cart

Rabbit polyclonal antibody raised against a full-length human NUDC protein.

NudC was first identified as a regulator of nuclear movement in the asexual reproductive cycle of the filamentous fungus Aspergillus nidulans. Human NUDC is a nuclear movement protein that associates with dynein (see DYNC1H1; MIM 600112) (Aumais et al., 2003 [PubMed 12679384]).[supplied by OMIM

Sequence: MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN

Specifications

Antigen nuclear distribution gene C homolog (A. nidulans)
Applications Immunofluorescence, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against a full-length human NUDC protein.
Formulation PBS with no preservative; pH 7.4
Gene NUDC
Gene Accession No. NM_006600
Gene Alias HNUDC/MNUDC/NPD011
Gene Symbols NUDC
Host Species Rabbit
Immunogen NUDC (NP_006591.1, 1 a.a. ∼ 331 a.a) full-length human protein.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Cycle
Primary or Secondary Primary
Gene ID (Entrez) 10726
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.