NUDT2, Mouse, Clone: 4A4-3C3, Abnova™

Catalog No.	Quantity
89-016-159	100 μg

Catalog No. 89-016-159 Supplier Abnova Corporation Supplier No. H00000318M01

Description

Mouse monoclonal antibody raised against a full-length recombinant NUDT2.

This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and three transcript variants, all encoding the same protein, have been identified. [provided by RefSeq

Sequence: MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA

Specifications

• Antigen: NUDT2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4A4-3C3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant NUDT2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: NUDT2
• Gene Accession No.: BC004926
• Gene Alias: APAH1/MGC10404
• Gene Symbols: NUDT2
• Host Species: Mouse
• Immunogen: NUDT2 (AAH04926, 1 a.a. ∼ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 318
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ