nudix (nucleoside diphosphate linked moiety X)-type motif 21, Mouse, Clone: 2G4-6F11, Abnova™

Catalog No.	Quantity
89-001-201	50 μg

Catalog No. 89-001-201 Supplier Abnova Corporation Supplier No. H00011051M01

Description

Mouse monoclonal antibody raised against a full-length recombinant NUDT21.

The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides. [provided by RefSeq]

Sequence: MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN

Specifications

• Antigen: nudix (nucleoside diphosphate linked moiety X)-type motif 21
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2G4-6F11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant NUDT21.
• Formulation: PBS with no preservative; pH 7.4
• Gene: NUDT21
• Gene Accession No.: BC001403
• Gene Alias: CFIM25/CPSF5/DKFZp686H1588
• Gene Symbols: NUDT21
• Host Species: Mouse
• Immunogen: NUDT21 (AAH01403, 1 a.a. ∼ 227 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 50 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 11051
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ