Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89007148

nudix (nucleoside diphosphate linked moiety X)-type motif 3, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89007148 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-007-148 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-007-148 Supplier Abnova Corporation Supplier No. H00011165B01
Only null left
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a full-length human NUDT3 protein.

NUDT3 belongs to the MutT, or Nudix, protein family. Nudix proteins act as homeostatic checkpoints at important stages in nucleoside phosphate metabolic pathways, guarding against elevated levels of potentially dangerous intermediates, like 8-oxo-dGTP, which promotes AT-to-CG transversions (Safrany et al., 1998 [PubMed 9822604]).[supplied by OMIM

Sequence: MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR

Specifications

Antigen nudix (nucleoside diphosphate linked moiety X)-type motif 3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a full-length human NUDT3 protein.
Formulation No additive
Gene NUDT3
Gene Accession No. NM_006703
Gene Alias DIPP/DIPP1
Gene Symbols NUDT3
Host Species Mouse
Immunogen NUDT3 (NP_006694, 1 a.a. ∼ 172 a.a) full-length human protein.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 11165
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.