nudix (nucleoside diphosphate linked moiety X)-type motif 3, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human NUDT3 protein.

Supplier:  Abnova Corporation H00011165B01

Catalog No. 89-007-148

Description

NUDT3 belongs to the MutT, or Nudix, protein family. Nudix proteins act as homeostatic checkpoints at important stages in nucleoside phosphate metabolic pathways, guarding against elevated levels of potentially dangerous intermediates, like 8-oxo-dGTP, which promotes AT-to-CG transversions (Safrany et al., 1998 [PubMed 9822604]).[supplied by OMIM

Sequence: MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR

Specifications

• Antigen: nudix (nucleoside diphosphate linked moiety X)-type motif 3
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human NUDT3 protein.
• Gene: NUDT3
• Gene Alias: DIPP/DIPP1
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_006703
• Gene Symbols: NUDT3
• Immunogen: NUDT3 (NP_006694, 1 a.a. ∼ 172 a.a) full-length human protein.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 11165
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.