occludin, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant OCLN.

Supplier:  Abnova Corporation H00004950A01

Catalog No. 89-004-220

Description

This gene encodes an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described. [provided by RefSeq

Sequence: ITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT

Specifications

• Antigen: occludin
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant OCLN.
• Gene: OCLN
• Gene Symbols: OCLN
• Immunogen: OCLN (NP_002529, 423 a.a. ∼ 522 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_002538
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 4950
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.