olfactomedin 1, Mouse, Clone: 2G12-1B3, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant OLFM1.

Supplier:  Abnova Corporation H00010439M01

Catalog No. 89-014-261

Description

This gene product shares extensive sequence similarity with the rat neuronal olfactomedin-related ER localized protein. While the exact function of the encoded protein is not known, its abundant expression in brain suggests that it may have an essential role in nerve tissue. Several alternatively spliced transcripts encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MPGRWRWQRDMHPARKLLSLLFLILMGTELTQNKRENKAEKMGGPESERKTTGEKTLNELPLFCLEAHAGSLALPRMCSPNPNPAVGLCRPAYPQSPSPGAAQTISQSLLERFCMASRREVFLAPGRPGGGWWLCTVAGQMHSFMCTHTHTHAHTGEQIPAEKSQPGPD

Specifications

• Antigen: olfactomedin 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC000189
• Gene Symbols: OLFM1
• Immunogen: OLFM1 (AAH00189, 1 a.a. ∼ 169 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Membrane Receptors
• Gene ID (Entrez): 10439
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ

• Applications: ELISA
• Clone: 2G12-1B3
• Description: Mouse monoclonal antibody raised against a full length recombinant OLFM1.
• Gene: OLFM1
• Gene Alias: AMY/NOE1/NOELIN1/OlfA
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody