Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

olfactomedin 1, Mouse, Clone: 2G12-1B3, Abnova™

Catalog No. 89014261 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-261 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-261 Supplier Abnova Corporation Supplier No. H00010439M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant OLFM1.

This gene product shares extensive sequence similarity with the rat neuronal olfactomedin-related ER localized protein. While the exact function of the encoded protein is not known, its abundant expression in brain suggests that it may have an essential role in nerve tissue. Several alternatively spliced transcripts encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MPGRWRWQRDMHPARKLLSLLFLILMGTELTQNKRENKAEKMGGPESERKTTGEKTLNELPLFCLEAHAGSLALPRMCSPNPNPAVGLCRPAYPQSPSPGAAQTISQSLLERFCMASRREVFLAPGRPGGGWWLCTVAGQMHSFMCTHTHTHAHTGEQIPAEKSQPGPD

Specifications

Antigen olfactomedin 1
Applications ELISA
Classification Monoclonal
Clone 2G12-1B3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant OLFM1.
Formulation PBS with no preservative; pH 7.4
Gene OLFM1
Gene Accession No. BC000189
Gene Alias AMY/NOE1/NOELIN1/OlfA
Gene Symbols OLFM1
Host Species Mouse
Immunogen OLFM1 (AAH00189, 1 a.a. ∼ 169 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Membrane Receptors
Primary or Secondary Primary
Gene ID (Entrez) 10439
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.