oligodendrocyte lineage transcription factor 2, Mouse, Clone: 3D7, Abnova™

Catalog No.	Quantity
89-001-168	100 μg

Catalog No. 89-001-168 Supplier Abnova Corporation Supplier No. H00010215M02

Description

Mouse monoclonal antibody raised against a full-length recombinant OLIG2.

This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. [provided by RefSeq

Sequence: DSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSS

Specifications

• Antigen: oligodendrocyte lineage transcription factor 2
• Applications: ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
• Classification: Monoclonal
• Clone: 3D7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant OLIG2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: OLIG2
• Gene Accession No.: NM_005806
• Gene Alias: BHLHB1/OLIGO2/PRKCBP2/RACK17/bHLHe19
• Gene Symbols: OLIG2
• Host Species: Mouse
• Immunogen: OLIG2 (NP_005797, 2 a.a. ∼ 78 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 10215
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ