orthodenticle homeobox 1, Mouse, Clone: 4E5, Abnova™

Catalog No.	Quantity
89-000-852	100 μg

Catalog No. 89-000-852 Supplier Abnova Corporation Supplier No. H00005013M03

Description

Mouse monoclonal antibody raised against a partial recombinant OTX1.

This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy. [provided by RefSeq

Sequence: YGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVR

Specifications

• Antigen: orthodenticle homeobox 1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4E5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant OTX1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: OTX1
• Gene Accession No.: NM_014562
• Gene Alias: FLJ38361/MGC15736
• Gene Symbols: OTX1
• Host Species: Mouse
• Immunogen: OTX1 (NP_055377, 10 a.a. ∼ 116 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5013
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ