PAFAH1B3, Mouse, Clone: 3G6, Abnova™

Catalog No.	Quantity
89-123-262	100 μg

Catalog No. 89-123-262 Supplier Abnova Corporation Supplier No. H00005050M08

Description

Mouse monoclonal antibody raised against a full-length recombinant PAFAH1B3.

This gene encodes an acetylhydrolase that catalyzes the removal of an acetyl group from the glycerol backbone of platelet-activating factor. The encoded enzyme is a subunit of the platelet-activating factor acetylhydrolase isoform 1B complex, which consists of the catalytic beta and gamma subunits and the regulatory alpha subunit. This complex functions in brain development. A translocation between this gene on chromosome 19 and the CDC-like kinase 2 gene on chromosome 1 has been observed, and was associated with mental retardation, ataxia, and atrophy of the brain. Alternatively spliced transcript variants have been described. [provided by RefSeq

Sequence: MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAP

Specifications

• Antigen: PAFAH1B3
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3G6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant PAFAH1B3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PAFAH1B3
• Gene Accession No.: BC003016
• Gene Symbols: PAFAH1B3
• Host Species: Mouse
• Immunogen: PAFAH1B3 (AAH03016, 1 a.a. ∼ 231 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5050
• Target Species: Human, Mouse, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ