PAK1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-050	50 μL

Catalog No. 89-003-050 Supplier Abnova Corporation Supplier No. H00005058A01

Description

Mouse polyclonal antibody raised against a partial recombinant PAK1.

PAK proteins are critical effectors that link RhoGTPases to cytoskeleton reorganization and nuclear signaling. PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. These proteins serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK1 regulates cell motility and morphology. Alternativelt spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: APRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGA

Specifications

• Antigen: PAK1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PAK1.
• Formulation: 50% glycerol
• Gene: PAK1
• Gene Accession No.: NM_002576
• Gene Alias: MGC130000/MGC130001/PAKalpha
• Gene Symbols: PAK1
• Host Species: Mouse
• Immunogen: PAK1 (NP_002567, 191 a.a. ∼ 280 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5058
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid