p21 protein (Cdc42/Rac)-activated kinase 3, Mouse, Clone: 1H7, Abnova™

Catalog No.	Quantity
89-000-856	100 μg

Catalog No. 89-000-856 Supplier Abnova Corporation Supplier No. H00005063M07

Description

Mouse monoclonal antibody raised against a partial recombinant PAK3.

PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. PAK proteins, a family of serine/threonine p21-activating kinases, serve as targets for the small GTP binding proteins Cdc42 and RAC and have been implicated in a wide range of biological activities. The protein encoded by this gene forms an activated complex with GTP-bound RAS-like (P21), CDC2 and RAC1 proteins which then catalyzes a variety of targets. This protein may be necessary for dendritic development and for the rapid cytoskeletal reorganization in dendritic spines associated with synaptic plasticity. Defects in this gene are the cause of nonsyndromic mental retardation X-linked type 30 (MRX30), also called X-linked mental retardation type 47 (MRX47). Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq

Sequence: MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGE

Specifications

• Antigen: p21 protein (Cdc42/Rac)-activated kinase 3
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 1H7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PAK3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PAK3
• Gene Accession No.: NM_002578
• Gene Alias: CDKN1A/MRX30/MRX47/OPHN3/PAK3beta/bPAK/hPAK3
• Gene Symbols: PAK3
• Host Species: Mouse
• Immunogen: PAK3 (NP_002569, 1 a.a. ∼ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5063
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ