Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

pantothenate kinase 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PANK1.

Manufacturer:  Abnova Corporation H00053354A01

Catalog No. 89-004-641


Add to cart

Description

Description

This gene encodes a protein belonging to the pantothenate kinase family. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynthetic pathway leading to CoA and is itself subject to regulation through feedback inhibition by CoA. Alternative splicing has been observed at this locus and three variants, each encoding a distinct isoform, have been identified. [provided by RefSeq

Sequence: IRFPSCAMHRFIQMGSEKNFSSLHTTLCATGGGAFKFEEDFRMIADLQLHKLDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYP
Specifications

Specifications

pantothenate kinase 1
Unconjugated
50% glycerol
NM_148977
MGC24596|PANK|PANK1a|PANK1b
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
53354
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant PANK1.
PANK1
Serum
PANK1
PANK1 (NP_683878, 310 a.a. ~ 409 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit