pantothenate kinase 1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-641	50 μL

Catalog No. 89-004-641 Supplier Abnova Corporation Supplier No. H00053354A01

Description

Mouse polyclonal antibody raised against a partial recombinant PANK1.

This gene encodes a protein belonging to the pantothenate kinase family. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynthetic pathway leading to CoA and is itself subject to regulation through feedback inhibition by CoA. Alternative splicing has been observed at this locus and three variants, each encoding a distinct isoform, have been identified. [provided by RefSeq

Sequence: IRFPSCAMHRFIQMGSEKNFSSLHTTLCATGGGAFKFEEDFRMIADLQLHKLDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYP

Specifications

• Antigen: pantothenate kinase 1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PANK1.
• Formulation: 50% glycerol
• Gene: PANK1
• Gene Accession No.: NM_148977
• Gene Alias: MGC24596/PANK/PANK1a/PANK1b
• Gene Symbols: PANK1
• Host Species: Mouse
• Immunogen: PANK1 (NP_683878, 310 a.a. ∼ 409 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 53354
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum