par-6 partitioning defective 6 homolog alpha (C. elegans) (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PARD6A.

Supplier:  Abnova Corporation H00050855A01

Catalog No. 89-004-616

Description

This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cell membrane protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex. The protein also has a role in the epithelial-to-mesenchymal transition (EMT) that characterizes the invasive phenotype associated with metastatic carcinomas. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: KPANQRNNVVRGASGRLTGPPSAGPGPAEPDSDDDSSDLVIENRQPPSSNGLSQGPPCWDLHPGCRHPGTRSSLPSLDDQGQASSGWGSRIRGDGSGFSL

Specifications

• Antigen: par-6 partitioning defective 6 homolog alpha (C. elegans)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant PARD6A.
• Gene: PARD6A
• Gene Alias: PAR-6A/PAR6/PAR6C/PAR6alpha/TAX40/TIP-40
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_016948
• Gene Symbols: PARD6A
• Immunogen: PARD6A (NP_058644, 247 a.a. ∼ 346 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 50855
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.