poly(A)-specific ribonuclease (deadenylation nuclease), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-225	50 μL

Catalog No. 89-004-225 Supplier Abnova Corporation Supplier No. H00005073A01

Description

Mouse polyclonal antibody raised against a partial recombinant PARN.

The protein encoded by this gene is a 3'-exoribonuclease, with similarity to the RNase D family of 3'-exonucleases. It prefers poly(A) as the substrate, hence, efficiently degrades poly(A) tails of mRNAs. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs. This protein is also involved in silencing of certain maternal mRNAs during oocyte maturation and early embryonic development, as well as in nonsense-mediated decay (NMD) of mRNAs that contain premature stop codons. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: AESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAE

Specifications

• Antigen: poly(A)-specific ribonuclease (deadenylation nuclease)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PARN.
• Formulation: 50% glycerol
• Gene: PARN
• Gene Accession No.: NM_002582
• Gene Alias: DAN
• Gene Symbols: PARN
• Host Species: Mouse
• Immunogen: PARN (NP_002573, 501 a.a. ∼ 599 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5073
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum