paired box 2, Mouse, Clone: 3C7, Abnova™

Catalog No.	Quantity
89-014-160	100 μg

Catalog No. 89-014-160 Supplier Abnova Corporation Supplier No. H00005076M01

Description

Mouse monoclonal antibody raised against a partial recombinant PAX2.

PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq

Sequence: PRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYP

Specifications

• Antigen: paired box 2
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 3C7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PAX2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PAX2
• Gene Accession No.: NM_000278
• Gene Symbols: PAX2
• Host Species: Mouse
• Immunogen: PAX2 (NP_000269, 194 a.a. ∼ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5076
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ