paired box 9, Mouse, Clone: 4B9, Abnova™

Catalog No.	Quantity
89-000-861	100 μg

Catalog No. 89-000-861 Supplier Abnova Corporation Supplier No. H00005083M03

Description

Mouse monoclonal antibody raised against a full-length recombinant PAX9.

This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 9 gene is unknown but it may involve development of stratified squamous epithelia as well as various organs and skeletal elements. [provided by RefSeq

Sequence: RSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGH

Specifications

• Antigen: paired box 9
• Applications: ELISA, KnockDown, Western Blot
• Classification: Monoclonal
• Clone: 4B9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant PAX9.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PAX9
• Gene Accession No.: NM_006194
• Gene Symbols: PAX9
• Host Species: Mouse
• Immunogen: PAX9 (NP_006185, 205 a.a. ∼ 300 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5083
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ