PDZ binding kinase, Mouse, Clone: 3A11, Abnova™

Catalog No.	Quantity
89-001-313	100 μg

Catalog No. 89-001-313 Supplier Abnova Corporation Supplier No. H00055872M11

Description

Mouse monoclonal antibody raised against a partial recombinant PBK.

This genes encodes a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. [provided by RefSeq

Sequence: MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGS

Specifications

• Antigen: PDZ binding kinase
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 3A11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PBK.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PBK
• Gene Accession No.: BC015191
• Gene Alias: FLJ14385/Nori-3/SPK/TOPK
• Gene Symbols: PBK
• Host Species: Mouse
• Immunogen: PBK (AAH15191, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 55872
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ