protocadherin 1, Mouse, Clone: 4H2, Abnova™

Catalog No.	Quantity
89-000-865	100 μg

Catalog No. 89-000-865 Supplier Abnova Corporation Supplier No. H00005097M02

Description

Mouse monoclonal antibody raised against a partial recombinant PCDH1.

This gene belongs to the protocadherin subfamily within the cadherin superfamily. The encoded protein is a membrane protein found at cell-cell boundaries. It is involved in neural cell adhesion, suggesting a possible role in neuronal development. The protein includes an extracelllular region, containing 7 cadherin-like domains, a transmembrane region and a C-terminal cytoplasmic region. Cells expressing the protein showed cell aggregation activity. Alternative splicing occurs in this gene. [provided by RefSeq

Sequence: YKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFA

Specifications

• Antigen: protocadherin 1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4H2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PCDH1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PCDH1
• Gene Accession No.: NM_002587
• Gene Alias: FLJ53887/MGC45991/PC42/PCDH42
• Gene Symbols: PCDH1
• Host Species: Mouse
• Immunogen: PCDH1 (NP_002578, 62 a.a. ∼ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5097
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ