protocadherin 11 Y-linked, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-732	50 μL

Catalog No. 89-004-732 Supplier Abnova Corporation Supplier No. H00083259A01

Description

Mouse polyclonal antibody raised against a partial recombinant PCDH11Y.

This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The encoded protein consists of an extracellular domain containing 7 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those of the classical cadherins. The gene is located in a major X/Y block of homology and its most closely related cadherin superfamily member is located in this homologous region on the X chromosome. The protein is thought to play a fundamental role in cell-cell recognition essential for the segmental development and function of the central nervous system. Transcripts arising from alternative splicing encode isoforms with N- and C-terminal variation. [provided by RefSeq

Sequence: EKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDIN

Specifications

• Antigen: protocadherin 11 Y-linked
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PCDH11Y.
• Formulation: 50% glycerol
• Gene: PCDH11Y
• Gene Accession No.: NM_032973
• Gene Alias: PCDH-PC/PCDH11X/PCDH22/PCDHY
• Gene Symbols: PCDH11Y
• Host Species: Mouse
• Immunogen: PCDH11Y (NP_004733, 57 a.a. ∼ 165 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Cell Adhesion
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 83259
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum