Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89014163

protocadherin 7, Mouse, Clone: 2D7, Abnova™

Catalog No. 89014163 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-163 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-163 Supplier Abnova Corporation Supplier No. H00005099M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant PCDH7.

This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The gene encodes a protein with an extracellular domain containing 7 cadherin repeats. The gene product is an integral membrane protein that is thought to function in cell-cell recognition and adhesion. Alternative splicing yields isoforms with unique cytoplasmic tails. [provided by RefSeq

Sequence: KQLLRYRLAEEGPADVRIGNVASDLGIVTGSGEVTFSLESGSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWV

Specifications

Antigen protocadherin 7
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2D7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant PCDH7.
Formulation PBS with no preservative; pH 7.4
Gene PCDH7
Gene Accession No. NM_002589
Gene Alias BH-Pcdh/BHPCDH
Gene Symbols PCDH7
Host Species Mouse
Immunogen PCDH7 (NP_002580, 31 a.a. ∼ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Adhesion
Primary or Secondary Primary
Gene ID (Entrez) 5099
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.