protocadherin alpha 5, Mouse, Clone: 1E8, Abnova™

Catalog No.	Quantity
89-001-543	200 μL

Catalog No. 89-001-543 Supplier Abnova Corporation Supplier No. H00056143M01A

Description

Mouse monoclonal antibody raised against a partial recombinant PCDHA5.

This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined. [provided by RefSeq

Sequence: TNEEETNFLELVLRKSLDREETQEHRLLVIATDGGKPELTGTVQLLINVLDANDNAPEFDKSIYNVRLLENAPSGTLVIKLNASDADEGINKEIVYFFSNLVLDDVK

Specifications

• Antigen: protocadherin alpha 5
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1E8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PCDHA5.
• Formulation: ascites with no preservative
• Gene: PCDHA5
• Gene Accession No.: NM_018908
• Gene Alias: CNR6/CNRN6/CNRS6/CRNR6/PCDH-ALPHA5
• Gene Symbols: PCDHA5
• Host Species: Mouse
• Immunogen: PCDHA5 (NP_061731, 183 a.a. ∼ 289 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Research Discipline: Cell Adhesion
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 56143
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ