protocadherin beta 1, Mouse, Clone: 1H4, Abnova™

Catalog No.	Quantity
89-001-536	200 μL

Catalog No. 89-001-536 Supplier Abnova Corporation Supplier No. H00029930M01A

Description

Mouse monoclonal antibody raised against a partial recombinant PCDHB1.

This gene is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked on chromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The beta cluster contains 16 genes and 3 pseudogenes, each encoding 6 extracellular cadherin domains and a cytoplasmic tail that deviates from others in the cadherin superfamily. The extracellular domains interact in a homophilic manner to specify differential cell-cell connections. Unlike the alpha and gamma clusters, the transcripts from these genes are made up of only one large exon, not sharing common 3' exons as expected. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins. Their specific functions are unknown but they most likely play a critical role in the establishment and function of specific cell-cell neural connections. [provided by RefSeq]

Sequence: QFSRLVYRAQVSENSPNGSLVATVTAVDLDEGTNKAITYSLAQNPEAILKTFQIDPQNGEVRLRGPLDFEAIETYDIDIQATDGGGLSAHSKVLVEVVDV

Specifications

• Antigen: protocadherin beta 1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1H4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PCDHB1.
• Formulation: ascites with no preservative
• Gene: PCDHB1
• Gene Accession No.: NM_013340
• Gene Alias: MGC138301/MGC138303/PCDH-BETA1
• Gene Symbols: PCDHB1
• Host Species: Mouse
• Immunogen: PCDHB1 (NP_037472, 241 a.a. ∼ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Research Discipline: Cell Adhesion
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 29930
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ