Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89004746

polycomb group ring finger 1, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004746 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-746 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-746 Supplier Abnova Corporation Supplier No. H00084759A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant PCGF1.

PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development (Nunes et al., 2001 [PubMed 11287196]). See also PCGF2 (MIM 600346).[supplied by OMIM

Sequence: DSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAE

Specifications

Antigen polycomb group ring finger 1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant PCGF1.
Formulation 50% glycerol
Gene PCGF1
Gene Accession No. NM_032673
Gene Alias 2010002K04Rik/FLJ43754/MGC10882/NSPC1/RNF3A-2/RNF68
Gene Symbols PCGF1
Host Species Mouse
Immunogen PCGF1 (NP_116062, 105 a.a. ∼ 187 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Ubiquitin/Proteasome
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 84759
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.