Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

polycomb group ring finger 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PCGF1.

Supplier:  Abnova Corporation H00084759A01

Catalog No. 89-004-746


Only null left
Add to Cart

Description

Description

PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development (Nunes et al., 2001 [PubMed 11287196]). See also PCGF2 (MIM 600346).[supplied by OMIM

Sequence: DSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAE
Specifications

Specifications

polycomb group ring finger 1
Polyclonal
Mouse polyclonal antibody raised against a partial recombinant PCGF1.
PCGF1
2010002K04Rik/FLJ43754/MGC10882/NSPC1/RNF3A-2/RNF68
Mouse
50 μL
Ubiquitin/Proteasome
Primary
Human
Serum
ELISA, Western Blot
Unconjugated
50% glycerol
NM_032673
PCGF1
PCGF1 (NP_116062, 105 a.a. ∼ 187 a.a) partial recombinant protein with GST tag.
RUO
Yes
84759
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.