Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

phosphate cytidylyltransferase 1, choline, beta, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PCYT1B.

Manufacturer:  Abnova Corporation H00009468A01

Catalog No. 89-004-441


Add to cart

Description

Description

The protein encoded by this gene belongs to the cytidylyltransferase family. It is involved in the regulation of phosphatidylcholine biosynthesis. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: NEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWKQMFQERSSRMLQAL
Specifications

Specifications

phosphate cytidylyltransferase 1, choline, beta
Unconjugated
50% glycerol
NM_004845
CCT-beta|CTB
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
9468
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant PCYT1B.
PCYT1B
Serum
PCYT1B
PCYT1B (NP_004836, 236 a.a. ~ 314 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit