Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000870

phosphodiesterase 1B, calmodulin-dependent, Mouse, Clone: 4F9, Abnova™

Catalog No. 89000870 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-870 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-870 Supplier Abnova Corporation Supplier No. H00005153M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant PDE1B.

Sequence: TDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD

Specifications

Antigen phosphodiesterase 1B, calmodulin-dependent
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4F9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant PDE1B.
Formulation PBS with no preservative; pH 7.4
Gene PDE1B
Gene Accession No. BC032226
Gene Alias PDE1B1/PDES1B
Gene Symbols PDE1B
Host Species Mouse
Immunogen PDE1B (AAH32226, 437 a.a. ∼ 536 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Apoptosis
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 5153
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG3 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.