platelet derived growth factor C (B01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-007-919	50 μL

Catalog No. 89-007-919 Supplier Abnova Corporation Supplier No. H00056034B01

Description

Mouse polyclonal antibody raised against a full-length human PDGFC protein.

The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines. This gene product appears to form only homodimers. It differs from the platelet-derived growth factor alpha and beta polypeptides in having an unusual N-terminal domain, the CUB domain. [provided by RefSeq

Sequence: MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHSPRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTILGRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSALPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG

Specifications

• Antigen: platelet derived growth factor C
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human PDGFC protein.
• Formulation: No additive
• Gene: PDGFC
• Gene Accession No.: NM_016205
• Gene Alias: FALLOTEIN/SCDGF
• Gene Symbols: PDGFC
• Host Species: Mouse
• Immunogen: PDGFC (NP_057289.1, 1 a.a. ∼ 345 a.a) full-length human protein.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 56034
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum