pyruvate dehydrogenase kinase, isozyme 1, Mouse, Clone: 3B7, Abnova™

Catalog No.	Quantity
89-000-871	100 μg

Catalog No. 89-000-871 Supplier Abnova Corporation Supplier No. H00005163M01

Description

Mouse monoclonal antibody raised against a partial recombinant PDK1.

Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation. [provided by RefSeq

Sequence: GGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQ

Specifications

• Antigen: pyruvate dehydrogenase kinase, isozyme 1
• Applications: ELISA
• Classification: Monoclonal
• Clone: 3B7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PDK1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PDK1
• Gene Accession No.: BC039158
• Gene Symbols: PDK1
• Host Species: Mouse
• Immunogen: PDK1 (AAH39158, 203 a.a. ∼ 302 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5163
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ