Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89123263

PDYN, Mouse, Clone: 2E12, Abnova™

Catalog No. 89123263 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-123-263 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-123-263 Supplier Abnova Corporation Supplier No. H00005173M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant PDYN.

The protein encoded by this gene is a preproprotein that is proteolytically processed to form the secreted opioid peptides beta-neoendorphin, dynorphin, leu-enkephalin, rimorphin, and leumorphin. These peptides are ligands for the kappa-type of opioid receptor. Dynorphin is involved in modulating responses to several psychoactive substances, including cocaine. [provided by RefSeq

Sequence: KRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQEDPNAYSGELFDA

Specifications

Antigen PDYN
Applications ELISA, Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 2E12
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant PDYN.
Formulation PBS with no preservative; pH 7.4
Gene PDYN
Gene Accession No. NM_024411
Gene Alias MGC26418/PENKB
Gene Symbols PDYN
Host Species Mouse
Immunogen PDYN (NP_077722.1, 205 a.a. ∼ 254 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5173
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.