PDYN, Mouse, Clone: 2E12, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PDYN.

Supplier:  Abnova Corporation H00005173M01

Catalog No. 89-123-263

Description

The protein encoded by this gene is a preproprotein that is proteolytically processed to form the secreted opioid peptides beta-neoendorphin, dynorphin, leu-enkephalin, rimorphin, and leumorphin. These peptides are ligands for the kappa-type of opioid receptor. Dynorphin is involved in modulating responses to several psychoactive substances, including cocaine. [provided by RefSeq

Sequence: KRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQEDPNAYSGELFDA

Specifications

• Antigen: PDYN
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_024411
• Gene Symbols: PDYN
• Immunogen: PDYN (NP_077722.1, 205 a.a. ∼ 254 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Immunoprecipitation, Western Blot
• Clone: 2E12
• Description: Mouse monoclonal antibody raised against a partial recombinant PDYN.
• Gene: PDYN
• Gene Alias: MGC26418/PENKB
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 5173
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid