peroxisomal biogenesis factor 7, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-234	50 μL

Catalog No. 89-004-234 Supplier Abnova Corporation Supplier No. H00005191A01

Description

Mouse polyclonal antibody raised against a partial recombinant PEX7.

This gene encodes the cytosolic receptor for the set of peroxisomal matrix enzymes targeted to the organelle by the peroxisome targeting signal 2 (PTS2). Defects in this gene cause peroxisome biogenesis disorders (PBDs), which are characterized by multiple defects in peroxisome function. There are at least 14 complementation groups for PBDs, with more than one phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene have been associated with PBD complementation group 11 (PBD-CG11) disorders, rhizomelic chondrodysplasia punctata type 1 (RCDP1), and Refsum disease (RD). [provided by RefSeq

Sequence: SAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLILDPDEAGLRLFRSFDWNDGLFDVTWSENNEHVLITCSGDGSLQLWDTAK

Specifications

• Antigen: peroxisomal biogenesis factor 7
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PEX7.
• Formulation: 50% glycerol
• Gene: PEX7
• Gene Accession No.: NM_000288
• Gene Alias: PTS2R/RCDP1/RD
• Gene Symbols: PEX7
• Host Species: Mouse
• Immunogen: PEX7 (NP_000279, 2 a.a. ∼ 99 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Membrane Receptors
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5191
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum