phosphoglycerate kinase 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PGK1.

Supplier:  Abnova Corporation H00005230A01

Catalog No. 89-004-240

Description

The protein encoded by this gene is a glycolytic enzyme that catalyzes the conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate. The encoded protein may also act as a cofactor for polymerase alpha. This gene lies on the X-chromosome, while a related pseudogene also has been found on the X-chromosome and another on chromosome 19. [provided by RefSeq

Sequence: SKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNI

Specifications

• Antigen: phosphoglycerate kinase 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant PGK1.
• Gene: PGK1
• Gene Alias: MGC117307/MGC142128/MGC8947/MIG10/PGKA
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 5230
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_000291
• Gene Symbols: PGK1
• Immunogen: PGK1 (NP_000282, 321 a.a. ∼ 417 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum