phosphoglycerate kinase 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PGK2.

Supplier:  Abnova Corporation H00005232A01

Catalog No. 89-004-241

Description

The PGK2 gene encodes a testis-specific form of phosphoglycerate kinase (EC 2.7.2.3), which catalyzes the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate during glycolysis, generating one molecule of ATP. See also PGK1 (MIM 311800), which is ubiquitously expressed in all somatic tissues and maps to chromosome Xq13.[supplied by OMIM

Sequence: DIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGP

Specifications

• Antigen: phosphoglycerate kinase 2
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant PGK2.
• Gene: PGK2
• Gene Alias: PGK-2/PGKB/PGKPS/dJ417L20.2
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 5232
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_138733
• Gene Symbols: PGK2
• Immunogen: PGK2 (NP_620061, 268 a.a. ∼ 339 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum