Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

phosphoglycerate kinase 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PGK2.

Manufacturer:  Abnova Corporation H00005232A01

Catalog No. 89-004-241


Add to cart

Description

Description

The PGK2 gene encodes a testis-specific form of phosphoglycerate kinase (EC 2.7.2.3), which catalyzes the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate during glycolysis, generating one molecule of ATP. See also PGK1 (MIM 311800), which is ubiquitously expressed in all somatic tissues and maps to chromosome Xq13.[supplied by OMIM

Sequence: DIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGP
Specifications

Specifications

phosphoglycerate kinase 2
Unconjugated
50% glycerol
NM_138733
PGK-2|PGKB|PGKPS|dJ417L20.2
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
5232
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant PGK2.
PGK2
Serum
PGK2
PGK2 (NP_620061, 268 a.a. ~ 339 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit