progesterone receptor, Mouse, Clone: 2C2, Abnova™

Catalog No.	Quantity
89-000-876	100 μg

Catalog No. 89-000-876 Supplier Abnova Corporation Supplier No. H00005241M04

Description

Mouse monoclonal antibody raised against a partial recombinant PGR. This PGR gene uses two distinct promoters and translation start sites in the first exon to produce two isoforms, A and B. The two isoforms are identical except for the additional 165 amino acids found in the N-terminus of isoform B. Our immunogen corresponds to the specific region of isoform B, thus this antibody is a PGR isofrom B specific antibody.

This gene encodes a member of the steroid receptor superfamily. The encoded protein mediates the physiological effects of progesterone, which plays a central role in reproductive events associated with the establishment and maintenance of pregnancy. This gene uses two distinct promotors and translation start sites in the first exon to produce two isoforms, A and B. The two isoforms are identical except for the additional 165 amino acids found in the N-terminus of isoform A only, and mediate their own response genes and physiologic effects with little overlap. The location of transcription initiation for isoform B has not been clearly determined. [provided by RefSeq

Sequence: MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGL

Specifications

• Antigen: progesterone receptor
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 2C2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PGR. This PGR gene uses two distinct promoters and translation start sites in the first exon to produce two isoforms, A and B. The two isoforms are identical except for the additional 165 amino acids found in the N-terminus of isoform B. Our immunogen corresponds to the specific region of isoform B, thus this antibody is a PGR isofrom B specific antibody.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PGR
• Gene Accession No.: NM_000926
• Gene Alias: NR3C3/PR
• Gene Symbols: PGR
• Host Species: Mouse
• Immunogen: PGR (NP_000917, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5241
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ