PHC1, Mouse, Clone: 3G1, Abnova™

Catalog No.	Quantity
89-021-392	100 μg

Catalog No. 89-021-392 Supplier Abnova Corporation Supplier No. H00001911M05

Description

Mouse monoclonal antibody raised against a partial recombinant PHC1.

This gene is a homolog of the Drosophila polyhomeotic gene, which is a member of the Polycomb group of genes. The gene product is a component of a multimeric protein complex that contains EDR2 and the vertebrate Polycomb protein BMH1. The gene product, the EDR2 protein, and the Drosophila polyhomeotic protein share 2 highly conserved domains, named homology domains I and II. These domains are involved in protein-protein interactions and may mediate heterodimerization of the protein encoded by this gene and the EDR2 protein. [provided by RefSeq

Sequence: PVGCSQLLKESEKPLQTGLPTGLTENQSGGPLGVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRKKMKEFQEANY*

Specifications

• Antigen: PHC1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3G1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PHC1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PHC1
• Gene Accession No.: NM_004426
• Gene Alias: EDR1/HPH1/RAE28
• Gene Symbols: PHC1
• Host Species: Mouse
• Immunogen: PHC1 (NP_004417, 751 a.a. ∼ 851 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1911
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ