PHD finger protein 1, Mouse, Clone: 2D3, Abnova™

Catalog No.	Quantity
89-000-877	100 μg

Catalog No. 89-000-877 Supplier Abnova Corporation Supplier No. H00005252M01

Description

Mouse monoclonal antibody raised against a partial recombinant PHF1.

This gene encodes a Polycomb group protein. The protein is a component of a histone H3 lysine-27 (H3K27)-specific methyltransferase complex, and functions in transcriptional repression of homeotic genes. The protein is also recruited to double-strand breaks, and reduced protein levels results in X-ray sensitivity and increased homologous recombination. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: AQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVP

Specifications

• Antigen: PHD finger protein 1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2D3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PHF1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PHF1
• Gene Accession No.: NM_024165
• Gene Alias: MTF2L2/PCL1/PHF2
• Gene Symbols: PHF1
• Host Species: Mouse
• Immunogen: PHF1 (NP_077084, 2 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5252
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ