PHF17, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human PHF17 protein.

Supplier:  Abnova Corporation H00079960B01P

Catalog No. 89-017-170

Description

Sequence: MKRGRLPSSSEDSDDNGSLSTTWSQNSRSQHRRSSCSRHEDRKPSEVFRTDLITAMKLHDSYQLNPDEYYVLADPWRQEWEKGVQVPVSPGTIPQPVARVVSEEKSLMFIRPKKYIVSSGSEPPELGYVDIRTLADSVCRYDLNDMDAAWLELTNEEFKEMGMPELDEYTMERVLEEFEQRCYDNMNHAIETEEGLGIEYDEDVVCDVCQSPDGEDGNEMVFCDKCNICVHQACYGILKVPEGSWLCRTCALGVQPKCLLCPKKGGAMKPTRSGTKWVHVSCALWIPEVSIGSPEKMEPITKVSHIPSSRWALVCSLCNEKFGASIQCSVKNCRTAFHVTCAFDRGLEMKTILAENDEVKFKSYCPKHSSHRKPEESLGKGAAQENGAPECSPRNPLEPFASLEQNREEAHRVSVRKQKLQQLEDEFYTFVNLLDVARALRLPEEVVDFLYQYWKLKRKVNFNKPLITPKKDEEDNLAKREQDVLFRRLQLFTHLRQDLERVMIDTDTL

Specifications

• Antigen: PHF17
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human PHF17 protein.
• Gene: PHF17
• Gene Alias: FLJ22479/JADE1/KIAA1807
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 79960
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Purified

• Applications: Immunofluorescence, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_024900
• Gene Symbols: PHF17
• Immunogen: PHF17 (NP_079176.2, 1 a.a. ∼ 509 a.a) full-length human protein.
• Quantity: 50 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG