Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000881

peptidylprolyl cis/trans isomerase, NIMA-interacting 1, Mouse, Clone: 5A8, Abnova™

Catalog No. 89000881 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-881 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-881 Supplier Abnova Corporation Supplier No. H00005300M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant PIN1.

The human PIN1 gene encodes an essential nuclear peptidylprolyl cis-trans isomerase (PPIase; EC 5.2.1.8) involved in regulation of mitosis. PIN1 belongs to a class of PPIases that includes the E. coli parvulin, yeast Ess1, and Drosophila dodo (dod) gene products (Lu et al., 1996 [PubMed 8606777]).[supplied by OMIM

Sequence: HSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE

Specifications

Antigen peptidylprolyl cis/trans isomerase, NIMA-interacting 1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 5A8
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant PIN1.
Formulation PBS with no preservative; pH 7.4
Gene PIN1
Gene Accession No. BC002899
Gene Alias DOD/UBL5
Gene Symbols PIN1
Host Species Mouse
Immunogen PIN1 (AAH02899, 64 a.a. ∼ 163 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Cycle
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 5300
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.