peptidylprolyl cis/trans isomerase, NIMA-interacting 1, Mouse, Clone: 5A8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PIN1.

Supplier:  Abnova Corporation H00005300M02

Catalog No. 89-000-881

Description

The human PIN1 gene encodes an essential nuclear peptidylprolyl cis-trans isomerase (PPIase; EC 5.2.1.8) involved in regulation of mitosis. PIN1 belongs to a class of PPIases that includes the E. coli parvulin, yeast Ess1, and Drosophila dodo (dod) gene products (Lu et al., 1996 [PubMed 8606777]).[supplied by OMIM

Sequence: HSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE

Specifications

• Antigen: peptidylprolyl cis/trans isomerase, NIMA-interacting 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC002899
• Gene Symbols: PIN1
• Immunogen: PIN1 (AAH02899, 64 a.a. ∼ 163 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 5A8
• Description: Mouse monoclonal antibody raised against a partial recombinant PIN1.
• Gene: PIN1
• Gene Alias: DOD/UBL5
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 5300
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ