Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

phosphatidylinositol-3-phosphate/phosphatidylinositol 5-kinase, type III, Mouse, Clone: 6C7, Abnova™

Catalog No. 89014351 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-351 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-351 Supplier Abnova Corporation Supplier No. H00200576M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant PIP5K3.

PIP5K3 belongs to a large family of lipid kinases that alter the phosphorylation status of intracellular phosphatidylinositol. Signaling by phosphorylated species of phosphatidylinositol regulates diverse cellular processes, including membrane trafficking and cytoskeletal reorganization (Shisheva et al., 1999 [PubMed 9858586]).[supplied by OMIM

Sequence: LQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPHPADQKGRR

Specifications

Antigen phosphatidylinositol-3-phosphate/phosphatidylinositol 5-kinase, type III
Applications ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), KnockDown, Western Blot
Classification Monoclonal
Clone 6C7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant PIP5K3.
Formulation PBS with no preservative; pH 7.4
Gene PIP5K3
Gene Accession No. NM_152671
Gene Alias CFD/FAB1/KIAA0981/MGC40423/PIKFYVE/PIP5K
Gene Symbols PIP5K3
Host Species Mouse
Immunogen PIP5K3 (NP_689884, 342 a.a. ∼ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Endocrine/Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 200576
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.